Lineage for d2nadb1 (2nad B:148-335)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308790Protein Formate dehydrogenase [51831] (1 species)
  7. 308791Species Pseudomonas sp., strain 101 [TaxId:306] [51832] (2 PDB entries)
  8. 308795Domain d2nadb1: 2nad B:148-335 [30091]
    Other proteins in same PDB: d2nada2, d2nadb2
    complexed with azi, nad, so4

Details for d2nadb1

PDB Entry: 2nad (more details), 2 Å

PDB Description: high resolution structures of holo and apo formate dehydrogenase

SCOP Domain Sequences for d2nadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nadb1 c.2.1.4 (B:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101}
isvaehvvmmilslvrnylpshewarkggwniadcvshaydleamhvgtvaagriglavl
rrlapfdvhlhytdrhrlpesvekelnltwhatredmypvcdvvtlncplhpetehmind
etlklfkrgayivntargklcdrdavaralesgrlagyagdvwfpqpapkdhpwrtmpyn
gmtphisg

SCOP Domain Coordinates for d2nadb1:

Click to download the PDB-style file with coordinates for d2nadb1.
(The format of our PDB-style files is described here.)

Timeline for d2nadb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nadb2