Lineage for d1evjc1 (1evj C:30-160,C:323-381)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66596Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 66597Species Zymomonas mobilis [TaxId:542] [51826] (2 PDB entries)
  8. 66606Domain d1evjc1: 1evj C:30-160,C:323-381 [30072]
    Other proteins in same PDB: d1evja2, d1evjb2, d1evjc2, d1evjd2

Details for d1evjc1

PDB Entry: 1evj (more details), 2.7 Å

PDB Description: crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d

SCOP Domain Sequences for d1evjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evjc1 c.2.1.3 (C:30-160,C:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
kklmigyrchyXnqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn
tdwgyvrqggy

SCOP Domain Coordinates for d1evjc1:

Click to download the PDB-style file with coordinates for d1evjc1.
(The format of our PDB-style files is described here.)

Timeline for d1evjc1: