SCOP 1.65: Domain d1ebud1: 1ebu D:2-150,D:341-359

Lineage for d1ebud1 (1ebu D:2-150,D:341-359)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Homoserine dehydrogenase [51815] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51816] (2 PDB entries)

8. Domain d1ebud1: 1ebu D:2-150,D:341-359 [30038]
   Other proteins in same PDB: d1ebua2, d1ebub2, d1ebuc2, d1ebud2
   complexed with hse, na, nda

Details for d1ebud1

PDB Entry: 1ebu, 2.6 Å

PDB Description: homoserine dehydrogenase complex with nad analogue and l-homoserine

SCOP Domain Sequences for d1ebud1:

Sequence; same for both SEQRES and ATOM records:

>d1ebud1 c.2.1.3 (D:2-150,D:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
sdlatwkalfsnkptngfvyheatvgaglXaavtaagvlgdvikiaqrl

Timeline for d1ebud1:

• d1ebud1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebud1 appears in SCOP 1.63
  
• d1ebud1 appears in SCOP 1.67
  
• d1ebud1 appears in the current release, SCOPe 2.08