Lineage for d1a7kb1 (1a7k B:1-165,B:335-358)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118545Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
  8. 118557Domain d1a7kb1: 1a7k B:1-165,B:335-358 [30009]
    Other proteins in same PDB: d1a7ka2, d1a7kb2, d1a7kc2, d1a7kd2

Details for d1a7kb1

PDB Entry: 1a7k (more details), 2.8 Å

PDB Description: glycosomal glyceraldehyde-3-phosphate dehydrogenase in a monoclinic crystal form

SCOP Domain Sequences for d1a7kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7kb1 c.2.1.3 (B:1-165,B:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1a7kb1:

Click to download the PDB-style file with coordinates for d1a7kb1.
(The format of our PDB-style files is described here.)

Timeline for d1a7kb1: