SCOP 1.61: Domain d1gypd1: 1gyp D:1-165,D:335-358

Lineage for d1gypd1 (1gyp D:1-165,D:335-358)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
Domain d1gypd1: 1gyp D:1-165,D:335-358 [30007]
Other proteins in same PDB: d1gypa2, d1gypb2, d1gypc2, d1gypd2

Details for d1gypd1

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

SCOP Domain Sequences for d1gypd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypd1 c.2.1.3 (D:1-165,D:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1gypd1:

Click to download the PDB-style file with coordinates for d1gypd1.
(The format of our PDB-style files is described here.)

Timeline for d1gypd1: