Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries) |
Domain d4o4hf1: 4o4h F:1-76 [299937] Other proteins in same PDB: d4o4ha1, d4o4ha2, d4o4hb1, d4o4hb2, d4o4hc1, d4o4hc2, d4o4hd1, d4o4hd2, d4o4he_, d4o4hf2, d4o4hf3 automated match to d3tiia1 complexed with acp, ca, gdp, gol, gtp, llm, mg |
PDB Entry: 4o4h (more details), 2.1 Å
SCOPe Domain Sequences for d4o4hf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4hf1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d4o4hf1: