SCOPe 2.03: Domain d1ybvb_: 1ybv B:

Lineage for d1ybvb_ (1ybv B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries)

8. Domain d1ybvb_: 1ybv B: [29949]
   complexed with bea, ndp

Details for d1ybvb_

PDB Entry: 1ybv, 2.8 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and an active site inhibitor

PDB Compounds: (B:) trihydroxynaphthalene reductase

SCOPe Domain Sequences for d1ybvb_:

Sequence; same for both SEQRES and ATOM records:

>d1ybvb_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Fungus (Magnaporthe grisea) [TaxId: 148305]}
daipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevvaa
ikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefdr
vftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcma
idmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvglpi
diarvvcflasndggwvtgkvigidggacm

Timeline for d1ybvb_:

• d1ybvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ybvb_ appears in SCOPe 2.02
  
• d1ybvb_ appears in SCOPe 2.04
  
• d1ybvb_ appears in the current release, SCOPe 2.08