Lineage for d1ybvb_ (1ybv B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20101Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)
  7. 20102Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (1 PDB entry)
  8. 20104Domain d1ybvb_: 1ybv B: [29949]

Details for d1ybvb_

PDB Entry: 1ybv (more details), 2.8 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and an active site inhibitor

SCOP Domain Sequences for d1ybvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybvb_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea)}
daipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevvaa
ikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefdr
vftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcma
idmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvglpi
diarvvcflasndggwvtgkvigidggacm

SCOP Domain Coordinates for d1ybvb_:

Click to download the PDB-style file with coordinates for d1ybvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ybvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ybva_