Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries) |
Domain d4i4tf2: 4i4t F:77-378 [298255] Other proteins in same PDB: d4i4ta1, d4i4ta2, d4i4tb1, d4i4tb2, d4i4tc1, d4i4tc2, d4i4td1, d4i4td2, d4i4te_, d4i4tf1, d4i4tf3 automated match to d3tiia2 complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn |
PDB Entry: 4i4t (more details), 1.8 Å
SCOPe Domain Sequences for d4i4tf2:
Sequence, based on SEQRES records: (download)
>d4i4tf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4i4tf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssaga kgegilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniyl yregvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdal nttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievnga pacaqklyaelcqgivdvaissvfplaptsifikl
Timeline for d4i4tf2: