Lineage for d1ek5a_ (1ek5 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 976419Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. 976441Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)
  8. 976454Domain d1ek5a_: 1ek5 A: [29802]
    complexed with nad

Details for d1ek5a_

PDB Entry: 1ek5 (more details), 1.8 Å

PDB Description: structure of human udp-galactose 4-epimerase in complex with nad+
PDB Compounds: (A:) udp-galactose 4-epimerase

SCOPe Domain Sequences for d1ek5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek5a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}
maekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsv
efeemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimk
ahgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwna
vllryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrd
yihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarr
egdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt

SCOPe Domain Coordinates for d1ek5a_:

Click to download the PDB-style file with coordinates for d1ek5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ek5a_: