Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species) |
Species Clostridium beijerinckii [TaxId:1520] [51743] (4 PDB entries) |
Domain d1pedd2: 1ped D:140-313 [29772] Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1 complexed with zn |
PDB Entry: 1ped (more details), 2.15 Å
SCOPe Domain Sequences for d1pedd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pedd2 c.2.1.1 (D:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr
Timeline for d1pedd2: