Lineage for d1btoc2 (1bto C:164-339)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826590Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 1826611Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1826628Species Horse (Equus caballus) [TaxId:9796] [51738] (41 PDB entries)
    Uniprot P00327
  8. 1826688Domain d1btoc2: 1bto C:164-339 [29695]
    Other proteins in same PDB: d1btoa1, d1btob1, d1btoc1, d1btod1
    complexed with nad, ssb, zn

Details for d1btoc2

PDB Entry: 1bto (more details), 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide
PDB Compounds: (C:) liver alcohol dehydrogenase

SCOPe Domain Sequences for d1btoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btoc2 c.2.1.1 (C:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1btoc2:

Click to download the PDB-style file with coordinates for d1btoc2.
(The format of our PDB-style files is described here.)

Timeline for d1btoc2: