Lineage for d1xind_ (1xin D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149743Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1149788Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1149789Protein D-xylose isomerase [51666] (13 species)
  7. 1149790Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 1149822Domain d1xind_: 1xin D: [29516]
    complexed with mg, xyl

Details for d1xind_

PDB Entry: 1xin (more details), 2.4 Å

PDB Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites
PDB Compounds: (D:) d-xylose isomerase

SCOPe Domain Sequences for d1xind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xind_ c.1.15.3 (D:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOPe Domain Coordinates for d1xind_:

Click to download the PDB-style file with coordinates for d1xind_.
(The format of our PDB-style files is described here.)

Timeline for d1xind_: