Lineage for d1clka_ (1clk A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149743Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1149788Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1149789Protein D-xylose isomerase [51666] (13 species)
  7. 1149894Species Streptomyces diastaticus, M1033 [TaxId:1956] [51671] (2 PDB entries)
  8. 1149897Domain d1clka_: 1clk A: [29438]
    complexed with co, mg

Details for d1clka_

PDB Entry: 1clk (more details), 1.9 Å

PDB Description: crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d1clka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clka_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces diastaticus, M1033 [TaxId: 1956]}
syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
gatdseraehikrfrqaldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
pdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d1clka_:

Click to download the PDB-style file with coordinates for d1clka_.
(The format of our PDB-style files is described here.)

Timeline for d1clka_: