Lineage for d1rldb1 (1rld B:148-467)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149523Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 1149524Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 1149525Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1149733Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 1149737Domain d1rldb1: 1rld B:148-467 [29329]
    Other proteins in same PDB: d1rlda2, d1rldb2, d1rlds_, d1rldt_

Details for d1rldb1

PDB Entry: 1rld (more details), 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase
PDB Compounds: (B:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rldb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rldb1 c.1.14.1 (B:148-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivf

SCOPe Domain Coordinates for d1rldb1:

Click to download the PDB-style file with coordinates for d1rldb1.
(The format of our PDB-style files is described here.)

Timeline for d1rldb1: