Lineage for d1pkya2 (1pky A:1-69,A:168-344)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824470Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1824471Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 1824472Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 1824480Species Escherichia coli [TaxId:562] [51628] (3 PDB entries)
  8. 1824485Domain d1pkya2: 1pky A:1-69,A:168-344 [29296]
    Other proteins in same PDB: d1pkya1, d1pkya3, d1pkyb1, d1pkyb3, d1pkyc1, d1pkyc3, d1pkyd1, d1pkyd3

Details for d1pkya2

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1pkya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkya2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmmldsmiknprptraeagdvanaildgtdavmlsgesakgkypleavsimaticertdr
vmnsrle

SCOPe Domain Coordinates for d1pkya2:

Click to download the PDB-style file with coordinates for d1pkya2.
(The format of our PDB-style files is described here.)

Timeline for d1pkya2: