Lineage for d1a5uf2 (1a5u F:3612-3715,F:3818-3995)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174373Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 174374Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 174375Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 174405Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (6 PDB entries)
  8. 174419Domain d1a5uf2: 1a5u F:3612-3715,F:3818-3995 [29268]
    Other proteins in same PDB: d1a5ua1, d1a5ua3, d1a5ub1, d1a5ub3, d1a5uc1, d1a5uc3, d1a5ud1, d1a5ud3, d1a5ue1, d1a5ue3, d1a5uf1, d1a5uf3, d1a5ug1, d1a5ug3, d1a5uh1, d1a5uh3

Details for d1a5uf2

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate

SCOP Domain Sequences for d1a5uf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5uf2 c.1.12.1 (F:3612-3715,F:3818-3995) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus)}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOP Domain Coordinates for d1a5uf2:

Click to download the PDB-style file with coordinates for d1a5uf2.
(The format of our PDB-style files is described here.)

Timeline for d1a5uf2: