Lineage for d1a5mc2 (1a5m C:130-422,C:476-567)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1820936Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 1820937Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 1820956Species Klebsiella aerogenes [TaxId:28451] [51562] (27 PDB entries)
  8. 1820972Domain d1a5mc2: 1a5m C:130-422,C:476-567 [29045]
    Other proteins in same PDB: d1a5ma_, d1a5mb_, d1a5mc1

Details for d1a5mc2

PDB Entry: 1a5m (more details), 2 Å

PDB Description: k217a variant of klebsiella aerogenes urease
PDB Compounds: (C:) urease (alpha subunit)

SCOPe Domain Sequences for d1a5mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5mc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglaihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d1a5mc2:

Click to download the PDB-style file with coordinates for d1a5mc2.
(The format of our PDB-style files is described here.)

Timeline for d1a5mc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5mc1