Lineage for d2xyla_ (2xyl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094224Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2094225Species Cellulomonas fimi [TaxId:1708] [51520] (14 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 2094237Domain d2xyla_: 2xyl A: [28917]

Details for d2xyla_

PDB Entry: 2xyl (more details), 1.9 Å

PDB Description: cellulomonas fimi xylanase/cellulase complexed with 2-deoxy-2-fluoro- xylobiose
PDB Compounds: (A:) beta-1,4-glycanase

SCOPe Domain Sequences for d2xyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xyla_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOPe Domain Coordinates for d2xyla_:

Click to download the PDB-style file with coordinates for d2xyla_.
(The format of our PDB-style files is described here.)

Timeline for d2xyla_: