Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (4 species) |
Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries) |
Domain d1ejuc1: 1eju C:1002-1129,C:1423-1475 [28422] Other proteins in same PDB: d1ejua_, d1ejub_, d1ejuc2 complexed with ni |
PDB Entry: 1eju (more details), 2 Å
SCOPe Domain Sequences for d1ejuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejuc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy rp
Timeline for d1ejuc1: