SCOPe 2.05: Domain d3ubpb_: 3ubp B:

Lineage for d3ubpb_ (3ubp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (8 PDB entries)

8. Domain d3ubpb_: 3ubp B: [28348]
   Other proteins in same PDB: d3ubpa_, d3ubpc1, d3ubpc2
   complexed with 2pa, ni

Details for d3ubpb_

PDB Entry: 3ubp, 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

PDB Compounds: (B:) protein (urease beta subunit)

SCOPe Domain Sequences for d3ubpb_:

Sequence; same for both SEQRES and ATOM records:

>d3ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d3ubpb_:

• d3ubpb_ first appeared (with stable ids) in SCOP 1.55
  
• d3ubpb_ appears in SCOPe 2.04
  
• d3ubpb_ appears in SCOPe 2.06
  
• d3ubpb_ appears in the current release, SCOPe 2.08