SCOPe 2.05: Domain d1fwfb_: 1fwf B:

Lineage for d1fwfb_ (1fwf B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1fwfb_: 1fwf B: [28326]
   Other proteins in same PDB: d1fwfa_, d1fwfc1, d1fwfc2
   complexed with ni

Details for d1fwfb_

PDB Entry: 1fwf, 2 Å

PDB Description: klebsiella aerogenes urease, c319d variant

PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1fwfb_:

Sequence; same for both SEQRES and ATOM records:

>d1fwfb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1fwfb_:

• d1fwfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwfb_ appears in SCOPe 2.04
  
• d1fwfb_ appears in SCOPe 2.06
  
• d1fwfb_ appears in the current release, SCOPe 2.08