SCOP 1.75: Domain d1e2vb2: 1e2v B:469-532

Lineage for d1e2vb2 (1e2v B:469-532)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1e2vb2: 1e2v B:469-532 [28255]
   Other proteins in same PDB: d1e2va1, d1e2vb1, d1e2vc1

Details for d1e2vb2

PDB Entry: 1e2v, 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii

PDB Compounds: (B:) cytochrome f

SCOP Domain Sequences for d1e2vb2:

Sequence; same for both SEQRES and ATOM records:

>d1e2vb2 b.84.2.2 (B:469-532) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1e2vb2:

• d1e2vb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e2vb2 appears in SCOP 1.73
  
• d1e2vb2 appears in SCOPe 2.01
  
• d1e2vb2 appears in the current release, SCOPe 2.08