Lineage for d1e2vb2 (1e2v B:469-532)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18007Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 18044Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 18070Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 18071Protein Cytochrome f, small domain [51257] (3 species)
  7. 18072Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (5 PDB entries)
  8. 18076Domain d1e2vb2: 1e2v B:469-532 [28255]
    Other proteins in same PDB: d1e2va1, d1e2vb1, d1e2vc1

Details for d1e2vb2

PDB Entry: 1e2v (more details), 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2vb2 b.84.2.2 (B:469-532) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOP Domain Coordinates for d1e2vb2:

Click to download the PDB-style file with coordinates for d1e2vb2.
(The format of our PDB-style files is described here.)

Timeline for d1e2vb2: