Lineage for d1ruoa2 (1ruo A:9-137)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082009Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 2082010Species Escherichia coli [TaxId:562] [51212] (31 PDB entries)
  8. 2082059Domain d1ruoa2: 1ruo A:9-137 [28144]
    Other proteins in same PDB: d1ruoa1, d1ruob1
    protein/DNA complex; complexed with cmp; mutant

Details for d1ruoa2

PDB Entry: 1ruo (more details), 2.7 Å

PDB Description: catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate
PDB Compounds: (A:) protein (catabolite gene activator protein (cap))

SCOPe Domain Sequences for d1ruoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruoa2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

SCOPe Domain Coordinates for d1ruoa2:

Click to download the PDB-style file with coordinates for d1ruoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ruoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruoa1