Lineage for d4zh1b_ (4zh1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335876Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2335880Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2335881Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)
  8. 2335903Domain d4zh1b_: 4zh1 B: [280571]
    Other proteins in same PDB: d4zh1a2
    automated match to d1ghqa_
    complexed with bgc, gal, gol, nga, sia

Details for d4zh1b_

PDB Entry: 4zh1 (more details), 2.24 Å

PDB Description: complement factor h in complex with the gm1 glycan
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d4zh1b_:

Sequence, based on SEQRES records: (download)

>d4zh1b_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
vtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafrqpss
afaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqedapv
ihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleanymnlq
rsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsyallallqlk
dfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapdhqelnldvslqlp

Sequence, based on observed residues (ATOM records): (download)

>d4zh1b_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
vtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqqlafrqpss
afaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdgvfqedapv
ihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfleanymnlq
rsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsyallallqlk
dfdfvppvvrwlneqrygstqatfmvfqalaqyqkdapdhqelnldvslqlp

SCOPe Domain Coordinates for d4zh1b_:

Click to download the PDB-style file with coordinates for d4zh1b_.
(The format of our PDB-style files is described here.)

Timeline for d4zh1b_: