Lineage for d4y0uc_ (4y0u C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245346Species Acinetobacter baumannii [TaxId:470] [194613] (47 PDB entries)
  8. 2245447Domain d4y0uc_: 4y0u C: [280516]
    automated match to d4k0xa_
    complexed with alp

Details for d4y0uc_

PDB Entry: 4y0u (more details), 2.6 Å

PDB Description: crystal structure of 6alpha-hydroxymethylpenicillanate complexed with oxa-58, a carbapenem hydrolyzing class d betalactamase from acinetobacter baumanii.
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d4y0uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y0uc_ e.3.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 470]}
iidqnvqalfneisadavfvtydgqnikkygthldraktayipastfkianaliglenhk
atsteifkwdgkprffkawdkdftlgeamqastvpvyqelarrigpslmqselqrigygn
mqigtevdqfwlkgpltitpiqevkfvydlaqgqlpfkpevqqqvkemlyverrgenrly
aksgwgmavdpqvgwyvgfvekadgqvvafalnmqmkagddialrkqlsldvldklgvfh
yl

SCOPe Domain Coordinates for d4y0uc_:

Click to download the PDB-style file with coordinates for d4y0uc_.
(The format of our PDB-style files is described here.)

Timeline for d4y0uc_: