Lineage for d5evib_ (5evi B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015020Species Pseudomonas syringae [TaxId:223283] [280374] (1 PDB entry)
  8. 3015022Domain d5evib_: 5evi B: [280378]
    automated match to d4hefa_
    complexed with edo, so4

Details for d5evib_

PDB Entry: 5evi (more details), 1.8 Å

PDB Description: crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
PDB Compounds: (B:) beta-lactamase/D-alanine carboxypeptidase

SCOPe Domain Sequences for d5evib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5evib_ e.3.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 223283]}
nsaaldtlvqtearkvmqennitglsiaitrhgkqqfynygvaskatgqpvssdtlfelg
sisktftatlatwaqangrlsltqsidtympplrdtrlgkipvfhlgthtaggfpiqvpe
kvqntrqlmdyfkawqpeylpgthrtyanpsigllgviaarsmnmpfqeamqqrlfpalg
lnstyvnvpddkqtlyaqgyntldepvrvnpgilaaeaygvksssrdlirfveaniglgq
ydaplqralsdtrigyfkvggmtqdlaweqyptpihldvllagnasamlntqkadaiepp
laaqptawvnktgstngfggyvafiaqkqlgivilanknypneervklayrilqhaepl

SCOPe Domain Coordinates for d5evib_:

Click to download the PDB-style file with coordinates for d5evib_.
(The format of our PDB-style files is described here.)

Timeline for d5evib_: