Lineage for d5evia_ (5evi A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245735Species Pseudomonas syringae [TaxId:223283] [280374] (1 PDB entry)
  8. 2245736Domain d5evia_: 5evi A: [280375]
    automated match to d4hefa_
    complexed with edo, so4

Details for d5evia_

PDB Entry: 5evi (more details), 1.8 Å

PDB Description: crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
PDB Compounds: (A:) beta-lactamase/D-alanine carboxypeptidase

SCOPe Domain Sequences for d5evia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5evia_ e.3.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]}
aaldtlvqtearkvmqennitglsiaitrhgkqqfynygvaskatgqpvssdtlfelgsi
sktftatlatwaqangrlsltqsidtympplrdtrlgkipvfhlgthtaggfpiqvpekv
qntrqlmdyfkawqpeylpgthrtyanpsigllgviaarsmnmpfqeamqqrlfpalgln
styvnvpddkqtlyaqgyntldepvrvnpgilaaeaygvksssrdlirfveaniglgqyd
aplqralsdtrigyfkvggmtqdlaweqyptpihldvllagnasamlntqkadaieppla
aqptawvnktgstngfggyvafiaqkqlgivilanknypneervklayrilqhaep

SCOPe Domain Coordinates for d5evia_:

Click to download the PDB-style file with coordinates for d5evia_.
(The format of our PDB-style files is described here.)

Timeline for d5evia_: