SCOPe 2.06: Domain d5df9a1: 5df9 A:53-221

Lineage for d5df9a1 (5df9 A:53-221)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (10 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [228776] (15 PDB entries)

8. Domain d5df9a1: 5df9 A:53-221 [280307]
   Other proteins in same PDB: d5df9a2
   automated match to d4kqra1
   complexed with 59j, gol, so4

Details for d5df9a1

PDB Entry: 5df9, 2.7 Å

PDB Description: crystal structure of penicillin-binding protein 3 in complex with deacylated product of cefoperazone

PDB Compounds: (A:) Cell division protein

SCOPe Domain Sequences for d5df9a1:

Sequence; same for both SEQRES and ATOM records:

>d5df9a1 d.175.1.0 (A:53-221) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfad
rieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvdd
rgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d5df9a1:

• d5df9a1 first appeared in SCOPe 2.05
  
• d5df9a1 appears in SCOPe 2.07
  
• d5df9a1 appears in the current release, SCOPe 2.08