Lineage for d5cbsc1 (5cbs C:0-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521254Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. 2521389Domain d5cbsc1: 5cbs C:0-259 [280121]
    Other proteins in same PDB: d5cbsc2, d5cbsd2
    automated match to d4igta_
    complexed with cl, e42, edo, gol, so4

Details for d5cbsc1

PDB Entry: 5cbs (more details), 1.8 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with the antagonist (r)-2-amino-3-(3'-hydroxybiphenyl-3-yl) propanoic acid at 1.8a resolution
PDB Compounds: (C:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5cbsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cbsc1 c.94.1.1 (C:0-259) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5cbsc1:

Click to download the PDB-style file with coordinates for d5cbsc1.
(The format of our PDB-style files is described here.)

Timeline for d5cbsc1: