SCOPe 2.05: Domain d5cbsc_: 5cbs C:

Lineage for d5cbsc_ (5cbs C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)

8. Domain d5cbsc_: 5cbs C: [280121]
   automated match to d4igta_
   complexed with cl, e42, edo, gol, so4

Details for d5cbsc_

PDB Entry: 5cbs, 1.8 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with the antagonist (r)-2-amino-3-(3'-hydroxybiphenyl-3-yl) propanoic acid at 1.8a resolution

PDB Compounds: (C:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5cbsc_:

Sequence; same for both SEQRES and ATOM records:

>d5cbsc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
anktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkl
neqglldklknkwwydkgecg

Timeline for d5cbsc_:

• d5cbsc_ is new in SCOPe 2.05-stable
  
• d5cbsc_ is called d5cbsc1 in SCOPe 2.06
  
• d5cbsc_ appears in the current release, SCOPe 2.08, called d5cbsc1