SCOPe 2.06: Domain d5ddog_: 5ddo G:

Lineage for d5ddog_ (5ddo G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (50 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d5ddog_: 5ddo G: [280001]
   automated match to d1dz5a_
   protein/RNA complex

Details for d5ddog_

PDB Entry: 5ddo, 3.1 Å

PDB Description: structural and dynamic basis for low affinity-high selectivity binding of l-glutamine by the gln-riboswitch

PDB Compounds: (G:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d5ddog_:

Sequence; same for both SEQRES and ATOM records:

>d5ddog_ d.58.7.1 (G:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsd

Timeline for d5ddog_:

• d5ddog_ first appeared in SCOPe 2.05
  
• d5ddog_ appears in SCOPe 2.07
  
• d5ddog_ appears in the current release, SCOPe 2.08