Lineage for d5e34b_ (5e34 B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267297Domain d5e34b_: 5e34 B: [279731]
    Other proteins in same PDB: d5e34a1, d5e34a2
    automated match to d4kdmb_
    complexed with gal, nag, sia; mutant

Details for d5e34b_

PDB Entry: 5e34 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n224k, q226l, n158d and l133a deletion) from the influenza virus a/chicken/vietnam/ncvd- 093/2008 (h5n1) with lsta
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5e34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e34b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgitnkinsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlye
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreeisg

SCOPe Domain Coordinates for d5e34b_:

Click to download the PDB-style file with coordinates for d5e34b_.
(The format of our PDB-style files is described here.)

Timeline for d5e34b_: