Lineage for d5dzne_ (5dzn E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767116Domain d5dzne_: 5dzn E: [279603]
    automated match to d3bi9x_

Details for d5dzne_

PDB Entry: 5dzn (more details), 2.3 Å

PDB Description: human t-cell immunoglobulin and mucin domain protein 4
PDB Compounds: (E:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d5dzne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dzne_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

SCOPe Domain Coordinates for d5dzne_:

Click to download the PDB-style file with coordinates for d5dzne_.
(The format of our PDB-style files is described here.)

Timeline for d5dzne_: