SCOPe 2.07: Domain d5egmb_: 5egm B:

Lineage for d5egmb_ (5egm B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57199] (29 PDB entries)

8. Domain d5egmb_: 5egm B: [279463]
   Other proteins in same PDB: d5egma_
   automated match to d2wphe_
   complexed with 5ny, na, nhe

Details for d5egmb_

PDB Entry: 5egm, 1.84 Å

PDB Description: development of a novel tricyclic class of potent and selective fixa inhibitors

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d5egmb_:

Sequence; same for both SEQRES and ATOM records:

>d5egmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

Timeline for d5egmb_:

• d5egmb_ first appeared in SCOPe 2.05
  
• d5egmb_ appears in SCOPe 2.06
  
• d5egmb_ appears in the current release, SCOPe 2.08