SCOPe 2.07: Domain d4r4ra_: 4r4r A:

Lineage for d4r4ra_ (4r4r A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [225853] (6 PDB entries)

8. Domain d4r4ra_: 4r4r A: [279332]
   automated match to d4id4a_
   complexed with cl, mg

Details for d4r4ra_

PDB Entry: 4r4r, 1.2 Å

PDB Description: crystal structure of chimeric beta-lactamase ctem-19m at 1.2 angstrom resolution

PDB Compounds: (A:) Beta-lactamase TEM,Beta-lactamase PSE-4

SCOPe Domain Sequences for d4r4ra_:

Sequence; same for both SEQRES and ATOM records:

>d4r4ra_ e.3.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d4r4ra_:

• d4r4ra_ first appeared in SCOPe 2.05
  
• d4r4ra_ appears in SCOPe 2.06
  
• d4r4ra_ appears in the current release, SCOPe 2.08