Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Lepus curpaeums [TaxId:9980] [279016] (1 PDB entry) |
Domain d4rzcf_: 4rzc F: [279020] Other proteins in same PDB: d4rzca_, d4rzcc_, d4rzce_, d4rzch_ automated match to d3t0va_ complexed with m6p, so4 |
PDB Entry: 4rzc (more details), 2.72 Å
SCOPe Domain Sequences for d4rzcf_:
Sequence, based on SEQRES records: (download)
>d4rzcf_ b.1.1.0 (F:) automated matches {Lepus curpaeums [TaxId: 9980]} lvmtqtespvsaavggtvtikcqssqsvynnrlawyqqkpgqrpklliysastlasgvps rfkgsgsgtqftltisdlewgdaatyychggyrsnddryafsggteleilss
>d4rzcf_ b.1.1.0 (F:) automated matches {Lepus curpaeums [TaxId: 9980]} lvmtqtespvsaaggtvtikcqssqsvynnrlawyqqkpgqrpklliysastlasgvpsr fkgsgsgtqftltisdlewgdaatyychggyrsnddryafsggteleilss
Timeline for d4rzcf_: