SCOPe 2.06: Domain d5d2mc_: 5d2m C:

Lineage for d5d2mc_ (5d2m C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein automated matches [191269] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries)

8. Domain d5d2mc_: 5d2m C: [278938]
   Other proteins in same PDB: d5d2ma_, d5d2mb_, d5d2md_, d5d2me1, d5d2me2
   automated match to d2grrb_
   complexed with edo

Details for d5d2mc_

PDB Entry: 5d2m, 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451

PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d5d2mc_:

Sequence; same for both SEQRES and ATOM records:

>d5d2mc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppadvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrma
vqdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqd
yfpkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d5d2mc_:

• d5d2mc_ first appeared in SCOPe 2.05
  
• d5d2mc_ appears in SCOPe 2.07
  
• d5d2mc_ appears in the current release, SCOPe 2.08