Lineage for d5ct8a_ (5ct8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870196Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 1870217Protein Lipase A [64145] (3 species)
    minimal alpha/beta hydrolase fold;
  7. 1870218Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
    Uniprot P37957 34-212
  8. 1870225Domain d5ct8a_: 5ct8 A: [278931]
    automated match to d1i6wb_
    complexed with so4; mutant

Details for d5ct8a_

PDB Entry: 5ct8 (more details), 1.29 Å

PDB Description: g158e/k44e/r57e/y49e bacillus subtilis lipase a with 0% [bmim][cl]
PDB Compounds: (A:) Quadruple mutant lipase A

SCOPe Domain Sequences for d5ct8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ct8a_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdetgtnenngpvlsefvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghiellyssqvnslikeglngggqntn

SCOPe Domain Coordinates for d5ct8a_:

Click to download the PDB-style file with coordinates for d5ct8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ct8a_: