Lineage for d5dmkg1 (5dmk G:1-84)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545619Protein automated matches [191280] (6 species)
    not a true protein
  7. 2545701Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)
  8. 2545708Domain d5dmkg1: 5dmk G:1-84 [278679]
    Other proteins in same PDB: d5dmka2, d5dmkc2, d5dmke2, d5dmkg2
    automated match to d1es0a2
    complexed with flc

Details for d5dmkg1

PDB Entry: 5dmk (more details), 2.45 Å

PDB Description: crystal structure of iag7 in complex with rlgl-we14
PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d5dmkg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmkg1 d.19.1.1 (G:1-84) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpa

SCOPe Domain Coordinates for d5dmkg1:

Click to download the PDB-style file with coordinates for d5dmkg1.
(The format of our PDB-style files is described here.)

Timeline for d5dmkg1: