Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries) |
Domain d5dmkg1: 5dmk G:1-84 [278679] Other proteins in same PDB: d5dmka2, d5dmkc2, d5dmke2, d5dmkg2 automated match to d1es0a2 complexed with flc |
PDB Entry: 5dmk (more details), 2.45 Å
SCOPe Domain Sequences for d5dmkg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dmkg1 d.19.1.1 (G:1-84) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg glqniaaekhnlgiltkrsnftpa
Timeline for d5dmkg1: