SCOPe 2.05: Domain d5dmke2: 5dmk E:85-173

Lineage for d5dmke2 (5dmk E:85-173)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)
Domain d5dmke2: 5dmk E:85-173 [278678]
Other proteins in same PDB: d5dmka1, d5dmkc1, d5dmke1, d5dmkg1
automated match to d1es0a1
complexed with flc

Details for d5dmke2

PDB Entry: 5dmk (more details), 2.45 Å

PDB Description: crystal structure of iag7 in complex with rlgl-we14

PDB Compounds: (E:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d5dmke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmke2 b.1.1.2 (E:85-173) automated matches {Mus musculus [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgle

SCOPe Domain Coordinates for d5dmke2:

Click to download the PDB-style file with coordinates for d5dmke2.
(The format of our PDB-style files is described here.)

Timeline for d5dmke2: