| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Mnemiopsis leidyi [TaxId:27923] [278472] (6 PDB entries) |
| Domain d4ykka_: 4ykk A: [278478] automated match to d2i0cb_ complexed with dsn, gly, mg |
PDB Entry: 4ykk (more details), 1.38 Å
SCOPe Domain Sequences for d4ykka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ykka_ c.94.1.0 (A:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
nligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpddrkf
galnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkgegtt
lnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrgglf
vfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegfidi
lwekwss
Timeline for d4ykka_: