Lineage for d5deqa1 (5deq A:1-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971760Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins)
    accosiated with the C-terminal "winged helix" domain (46785)
  6. 2971761Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species)
  7. 2971762Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (3 PDB entries)
    Uniprot Q8AAV8 3-149
  8. 2971763Domain d5deqa1: 5deq A:1-149 [278347]
    Other proteins in same PDB: d5deqa2, d5deqb2
    automated match to d2fb1a2
    complexed with ara, fmt, so4

Details for d5deqa1

PDB Entry: 5deq (more details), 1.95 Å

PDB Description: crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose
PDB Compounds: (A:) transcriptional regulator AraR

SCOPe Domain Sequences for d5deqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5deqa1 d.113.1.6 (A:1-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa
krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn
inelpalifdhpemvdkaremmkqkasve

SCOPe Domain Coordinates for d5deqa1:

Click to download the PDB-style file with coordinates for d5deqa1.
(The format of our PDB-style files is described here.)

Timeline for d5deqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5deqa2