SCOPe 2.05: Domain d4yp5c_: 4yp5 C:

Lineage for d4yp5c_ (4yp5 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (4 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [278209] (1 PDB entry)

8. Domain d4yp5c_: 4yp5 C: [278212]
   automated match to d1m8ka_
   complexed with nap

Details for d4yp5c_

PDB Entry: 4yp5, 2.21 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp

PDB Compounds: (C:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d4yp5c_:

Sequence; same for both SEQRES and ATOM records:

>d4yp5c_ c.26.1.3 (C:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
tmrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltka
lsengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtap
plfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak

Timeline for d4yp5c_:

• d4yp5c_ is new in SCOPe 2.05-stable
  
• d4yp5c_ is called d4yp5c1 in SCOPe 2.06
  
• d4yp5c_ appears in the current release, SCOPe 2.08, called d4yp5c1