SCOPe 2.08: Domain d5ctec1: 5cte C:1492-1814

Lineage for d5ctec1 (5cte C:1492-1814)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries)

8. Domain d5ctec1: 5cte C:1492-1814 [278057]
   automated match to d1uyta1
   complexed with 57l, so4

Details for d5ctec1

PDB Entry: 5cte, 2.34 Å

PDB Description: humanized yeast acc carboxyltransferase domain bound to 2,2- dimethylpropyl (1s)-1-methyl-8-[(7-methyl-1h-indazol-5-yl)carbonyl]- 2,8-diazaspiro[4.5]decane-2-carboxylate

PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5ctec1:

Sequence; same for both SEQRES and ATOM records:

>d5ctec1 c.14.1.4 (C:1492-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
svgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlggtqimynngvshl
tavddlagvekivewmsyvpakr

Timeline for d5ctec1:

• d5ctec1 first appeared in SCOPe 2.05
  
• d5ctec1 appears in SCOPe 2.07