SCOPe 2.06: Domain d1ehaa2: 1eha A:491-557

Lineage for d1ehaa2 (1eha A:491-557)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries)

8. Domain d1ehaa2: 1eha A:491-557 [27786]
   Other proteins in same PDB: d1ehaa1, d1ehaa3

Details for d1ehaa2

PDB Entry: 1eha, 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus

PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d1ehaa2:

Sequence; same for both SEQRES and ATOM records:

>d1ehaa2 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

Timeline for d1ehaa2:

• d1ehaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ehaa2 appears in SCOPe 2.05
  
• d1ehaa2 appears in SCOPe 2.07
  
• d1ehaa2 appears in the current release, SCOPe 2.08