SCOP 1.67: Domain d1bvzb2: 1bvz B:503-585

Lineage for d1bvzb2 (1bvz B:503-585)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)

8. Domain d1bvzb2: 1bvz B:503-585 [27784]
   Other proteins in same PDB: d1bvza1, d1bvza3, d1bvzb1, d1bvzb3

Details for d1bvzb2

PDB Entry: 1bvz, 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvzb2:

Sequence; same for both SEQRES and ATOM records:

>d1bvzb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1bvzb2:

• d1bvzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bvzb2 appears in SCOP 1.65
  
• d1bvzb2 appears in SCOP 1.69
  
• d1bvzb2 appears in the current release, SCOPe 2.08