SCOP 1.65: Domain d1ciu_3: 1ciu 407-495

Lineage for d1ciu_3 (1ciu 407-495)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries)

8. Domain d1ciu_3: 1ciu 407-495 [27759]
   Other proteins in same PDB: d1ciu_1, d1ciu_2, d1ciu_4
   complexed with ca

Details for d1ciu_3

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

SCOP Domain Sequences for d1ciu_3:

Sequence; same for both SEQRES and ATOM records:

>d1ciu_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

Timeline for d1ciu_3:

• d1ciu_3 first appeared (with stable ids) in SCOP 1.55
  
• d1ciu_3 appears in SCOP 1.63
  
• d1ciu_3 appears in SCOP 1.67
  
• d1ciu_3 appears in the current release, SCOPe 2.08, called d1ciua3