Lineage for d1ciu_3 (1ciu 407-495)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) Protein Cyclodextrin glycosyltransferase [51018] (5 species) 
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries) 
Domain d1ciu_3: 1ciu 407-495 [27759]
Other proteins in same PDB: d1ciu_1, d1ciu_2, d1ciu_4
Details for d1ciu_3
PDB Entry: 1ciu (more details), 2.3 Å
PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
SCOP Domain Sequences for d1ciu_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciu_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss
SCOP Domain Coordinates for d1ciu_3:
Click to download the PDB-style file with coordinates for d1ciu_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ciu_3:
- d1ciu_3 appears in SCOP 1.57
- d1ciu_3 appears in the current release, SCOPe 2.08, called d1ciua3
View in 3D
